Lineage for d1pxza_ (1pxz A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566895Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 566896Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 566897Family b.80.1.1: Pectate lyase-like [51127] (2 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 566898Protein Major pollen allergen Jun a 1 [117306] (1 species)
  7. 566899Species Ozark white cedar (Juniperus ashei) [TaxId:13101] [117307] (1 PDB entry)
  8. 566900Domain d1pxza_: 1pxz A: [111643]

Details for d1pxza_

PDB Entry: 1pxz (more details), 1.7 Å

PDB Description: 1.7 angstrom crystal structure of jun a 1, the major allergen from cedar pollen

SCOP Domain Sequences for d1pxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pxza_ b.80.1.1 (A:) Major pollen allergen Jun a 1 {Ozark white cedar (Juniperus ashei)}
dnpidscwrgdsnwdqnrmkladcavgfgsstmggkggdfytvtstddnpvnptpgtlry
gatrekalwiifsqnmniklkmplyvaghktidgrgadvhlgnggpclfmrkvshvilhs
lhihgcntsvlgdvlvsesigvepvhaqdgdaitmrnvtnawidhnslsdcsdglidvtl
gstgitisnnhffnhhkvmllghddtydddksmkvtvafnqfgpnagqrmpraryglvhv
annnydpwniyaiggssnptilsegnsftapsesykkevtkrigcespsacanwvwrstr
dafingayfvssgkteetniynsneafkvengnaapqltknagvvt

SCOP Domain Coordinates for d1pxza_:

Click to download the PDB-style file with coordinates for d1pxza_.
(The format of our PDB-style files is described here.)

Timeline for d1pxza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pxzb_