Lineage for d1ob9a_ (1ob9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882515Family c.52.1.18: Hjc-like [64080] (3 proteins)
    Pfam PF01870
  6. 2882526Protein Holliday-junction resolvase SSO1176 [117617] (1 species)
  7. 2882527Species Sulfolobus solfataricus [TaxId:2287] [117618] (2 PDB entries)
    Uniprot Q97YX6
  8. 2882530Domain d1ob9a_: 1ob9 A: [111629]
    complexed with edo, fmt

Details for d1ob9a_

PDB Entry: 1ob9 (more details), 2 Å

PDB Description: holliday junction resolving enzyme
PDB Compounds: (A:) holliday junction resolvase

SCOPe Domain Sequences for d1ob9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob9a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]}
gknaerelvsilrgegfnavriptsnsspnplpdifatkgntllsieckstwenkvkvke
hqvrklldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfkile
krie

SCOPe Domain Coordinates for d1ob9a_:

Click to download the PDB-style file with coordinates for d1ob9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ob9a_: