| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.18: Hjc-like [64080] (3 proteins) Pfam PF01870 |
| Protein Holliday-junction resolvase SSO1176 [117617] (1 species) |
| Species Sulfolobus solfataricus [TaxId:2287] [117618] (2 PDB entries) Uniprot Q97YX6 |
| Domain d1ob9a_: 1ob9 A: [111629] complexed with edo, fmt |
PDB Entry: 1ob9 (more details), 2 Å
SCOPe Domain Sequences for d1ob9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob9a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]}
gknaerelvsilrgegfnavriptsnsspnplpdifatkgntllsieckstwenkvkvke
hqvrklldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfkile
krie
Timeline for d1ob9a_: