SCOPe 2.08: Domain d1ob8b_: 1ob8 B:

Lineage for d1ob8b_ (1ob8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.18: Hjc-like [64080] (3 proteins)
   Pfam PF01870

6. Protein Holliday-junction resolvase SSO1176 [117617] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [117618] (2 PDB entries)
   Uniprot Q97YX6

8. Domain d1ob8b_: 1ob8 B: [111628]
   complexed with edo, so4

Details for d1ob8b_

PDB Entry: 1ob8, 1.8 Å

PDB Description: holliday junction resolving enzyme

PDB Compounds: (B:) holliday-junction resolvase

SCOPe Domain Sequences for d1ob8b_:

Sequence, based on SEQRES records:

>d1ob8b_ c.52.1.18 (B:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]}
digknaerelvsilrgegfnavriptsnsspnplpdifatkgntllsieckstwenkvkv
kehqvrklldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfki
lekrieekiltp

Sequence, based on observed residues (ATOM records):

>d1ob8b_ c.52.1.18 (B:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]}
digknaerelvsilrgegfnavriptnplpdifatkgntllsieckstwenkvkvkehqv
rklldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfkilekri
eekiltp

Timeline for d1ob8b_:

• d1ob8b_ first appeared in SCOP 1.71
  
• d1ob8b_ appears in SCOPe 2.07