Lineage for d1h48d1 (1h48 D:1-156)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960358Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2960359Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2960360Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 2960374Species Escherichia coli [TaxId:562] [69768] (14 PDB entries)
    Uniprot P62617 ! Uniprot P36663
  8. 2960399Domain d1h48d1: 1h48 D:1-156 [111624]
    Other proteins in same PDB: d1h48a2, d1h48b2, d1h48c2, d1h48d2, d1h48e2, d1h48f2
    complexed with c5p, cdi, gpp, mn, zn

Details for d1h48d1

PDB Entry: 1h48 (more details), 2.3 Å

PDB Description: the structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product
PDB Compounds: (D:) 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1h48d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h48d1 d.79.5.1 (D:1-156) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

SCOPe Domain Coordinates for d1h48d1:

Click to download the PDB-style file with coordinates for d1h48d1.
(The format of our PDB-style files is described here.)

Timeline for d1h48d1: