SCOPe 2.07: Domain d1h48c1: 1h48 C:1-157

Lineage for d1h48c1 (1h48 C:1-157)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Escherichia coli [TaxId:562] [69768] (14 PDB entries)
   Uniprot P62617 ! Uniprot P36663

8. Domain d1h48c1: 1h48 C:1-157 [111623]
   Other proteins in same PDB: d1h48a2, d1h48b2, d1h48c2, d1h48d2, d1h48e2, d1h48f2
   complexed with c5p, cdi, gpp, mn, zn

Details for d1h48c1

PDB Entry: 1h48, 2.3 Å

PDB Description: the structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product

PDB Compounds: (C:) 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1h48c1:

Sequence; same for both SEQRES and ATOM records:

>d1h48c1 d.79.5.1 (C:1-157) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallika

Timeline for d1h48c1:

• d1h48c1 first appeared in SCOP 1.71, called d1h48c_
  
• d1h48c1 appears in SCOPe 2.06
  
• d1h48c1 appears in the current release, SCOPe 2.08