![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
![]() | Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [69768] (14 PDB entries) Uniprot P62617 ! Uniprot P36663 |
![]() | Domain d1h48c1: 1h48 C:1-157 [111623] Other proteins in same PDB: d1h48a2, d1h48b2, d1h48c2, d1h48d2, d1h48e2, d1h48f2 complexed with c5p, cdi, gpp, mn, zn |
PDB Entry: 1h48 (more details), 2.3 Å
SCOPe Domain Sequences for d1h48c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h48c1 d.79.5.1 (C:1-157) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]} mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl gchmddvnvkattteklgftgrgegiaceavallika
Timeline for d1h48c1: