Lineage for d1h48b_ (1h48 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606302Superfamily d.79.5: IpsF-like [69765] (1 family) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 606303Family d.79.5.1: IpsF-like [69766] (2 proteins)
  6. 606304Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (4 species)
  7. 606305Species Escherichia coli [TaxId:562] [69768] (10 PDB entries)
  8. 606316Domain d1h48b_: 1h48 B: [111622]

Details for d1h48b_

PDB Entry: 1h48 (more details), 2.3 Å

PDB Description: the structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product

SCOP Domain Sequences for d1h48b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h48b_ d.79.5.1 (B:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli}
lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
dlgchmddvnvkattteklgftgrgegiaceavallik

SCOP Domain Coordinates for d1h48b_:

Click to download the PDB-style file with coordinates for d1h48b_.
(The format of our PDB-style files is described here.)

Timeline for d1h48b_: