SCOPe 2.08: Domain d2admb2: 2adm B:244-413

Lineage for d2admb2 (2adm B:244-413)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)

6. Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)

7. Species Thermus aquaticus [TaxId:271] [116737] (11 PDB entries)

8. Domain d2admb2: 2adm B:244-413 [111614]
   Other proteins in same PDB: d2adma1, d2admb1
   complexed with sam

Details for d2admb2

PDB Entry: 2adm, 2.6 Å

PDB Description: adenine-n6-dna-methyltransferase taqi

PDB Compounds: (B:) adenine-n6-DNA-methyltransferase taqi

SCOPe Domain Sequences for d2admb2:

Sequence; same for both SEQRES and ATOM records:

>d2admb2 d.287.1.1 (B:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

Timeline for d2admb2:

• d2admb2 first appeared in SCOP 1.71
  
• d2admb2 appears in SCOPe 2.07