Lineage for d2adma1 (2adm A:21-243)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 588996Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein)
  6. 588997Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 588998Species Thermus aquaticus [TaxId:271] [53370] (4 PDB entries)
  8. 589001Domain d2adma1: 2adm A:21-243 [111611]
    Other proteins in same PDB: d2adma2, d2admb2

Details for d2adma1

PDB Entry: 2adm (more details), 2.4 Å

PDB Description: adenine-n6-dna-methyltransferase taqi

SCOP Domain Sequences for d2adma1:

Sequence, based on SEQRES records: (download)

>d2adma1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

Sequence, based on observed residues (ATOM records): (download)

>d2adma1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgvfkavkdlykkafstwkgkynlygafle
kavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvsavvirf
qksgkglslwdtqesesgftpilwaeyphwegeii

SCOP Domain Coordinates for d2adma1:

Click to download the PDB-style file with coordinates for d2adma1.
(The format of our PDB-style files is described here.)

Timeline for d2adma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2adma2