Lineage for d1vk6a3 (1vk6 A:0-96)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609724Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 609725Superfamily d.113.1: Nudix [55811] (5 families) (S)
  5. 609850Family d.113.1.4: NADH pyrophosphatase [103214] (1 protein)
    duplication: consists of two structurally similar domains separated by a rubredoxin-like zinc finger; the N-terminal domain has a rudiment Nudix fold, the C-terminal, probably catalytic, domain has the canonical fold
  6. 609851Protein NADH pyrophosphatase [103215] (1 species)
  7. 609852Species Escherichia coli [TaxId:562] [103216] (1 PDB entry)
  8. 609854Domain d1vk6a3: 1vk6 A:0-96 [111609]
    Other proteins in same PDB: d1vk6a4

Details for d1vk6a3

PDB Entry: 1vk6 (more details), 2.2 Å

PDB Description: crystal structure of nadh pyrophosphatase (1790429) from escherichia coli k12 at 2.20 a resolution

SCOP Domain Sequences for d1vk6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk6a3 d.113.1.4 (A:0-96) NADH pyrophosphatase {Escherichia coli}
hmdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqgepvwlvqq
qrrhdmgsvrqvidldvglfqlagrgvqlaefyrshk

SCOP Domain Coordinates for d1vk6a3:

Click to download the PDB-style file with coordinates for d1vk6a3.
(The format of our PDB-style files is described here.)

Timeline for d1vk6a3: