SCOP 1.71: Domain d1tthc2: 1tth C:1-150

Lineage for d1tthc2 (1tth C:1-150)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)

8. Domain d1tthc2: 1tth C:1-150 [111603]
   Other proteins in same PDB: d1tthb1, d1tthb2, d1tthd1, d1tthd2

Details for d1tthc2

PDB Entry: 1tth, 2.8 Å

PDB Description: aspartate transcarbamoylase catalytic chain mutant glu50ala complexed with n-(phosphonacetyl-l-aspartate) (pala)

SCOP Domain Sequences for d1tthc2:

Sequence; same for both SEQRES and ATOM records:

>d1tthc2 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffaastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1tthc2:

• d1tthc2 is new in SCOP 1.71
  
• d1tthc2 appears in SCOP 1.73
  
• d1tthc2 appears in the current release, SCOPe 2.08