Lineage for d1q8ka4 (1q8k A:3-88)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789119Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species)
  7. 1789122Species Human (Homo sapiens) [TaxId:9606] [74951] (2 PDB entries)
    Uniprot P05198
  8. 1789124Domain d1q8ka4: 1q8k A:3-88 [111597]
    Other proteins in same PDB: d1q8ka2, d1q8ka3

Details for d1q8ka4

PDB Entry: 1q8k (more details)

PDB Description: Solution structure of alpha subunit of human eIF2
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 subunit 1

SCOPe Domain Sequences for d1q8ka4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ka4 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mscrfyqhkfpevedvvmvnvrsiqemgayvslleynniegmihlselsrrrirsinkli
rigrnecvkvirvdkekgyidlskrr

SCOPe Domain Coordinates for d1q8ka4:

Click to download the PDB-style file with coordinates for d1q8ka4.
(The format of our PDB-style files is described here.)

Timeline for d1q8ka4: