Lineage for d1q8ka3 (1q8k A:89-185)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643505Superfamily a.60.14: eIF2alpha middle domain-like [116742] (1 family) (S)
  5. 643506Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)
  6. 643507Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)
  7. 643510Species Human (Homo sapiens) [TaxId:9606] [116745] (2 PDB entries)
  8. 643512Domain d1q8ka3: 1q8k A:89-185 [111596]
    Other proteins in same PDB: d1q8ka2, d1q8ka4

Details for d1q8ka3

PDB Entry: 1q8k (more details)

PDB Description: solution structure of alpha subunit of human eif2
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 subunit 1

SCOP Domain Sequences for d1q8ka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ka3 a.60.14.1 (A:89-185) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
vspeeaikcedkftksktvysilrhvaevleytkdeqleslfqrtawvfddkykrpgyga
ydafkhavsdpsildsldlnederevlinninrrltp

SCOP Domain Coordinates for d1q8ka3:

Click to download the PDB-style file with coordinates for d1q8ka3.
(The format of our PDB-style files is described here.)

Timeline for d1q8ka3: