Lineage for d1q46a2 (1q46 A:2-88)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
barrel, closed; n=5, S=8
Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (2 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101764] (1 PDB entry) 
Domain d1q46a2: 1q46 A:2-88 [111595]
Other proteins in same PDB: d1q46a1
Details for d1q46a2
PDB Entry: 1q46 (more details), 2.86 Å
PDB Description: crystal structure of the eIF2 alpha subunit from saccharomyces cerevisia
SCOP Domain Sequences for d1q46a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q46a2 b.40.4.5 (A:2-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
tshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqkl
irvgkndvavvlrvdkekgyidlskrr
SCOP Domain Coordinates for d1q46a2:
Click to download the PDB-style file with coordinates for d1q46a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q46a2:
- d1q46a2 is new in SCOP 1.71
- d1q46a2 appears in SCOP 1.73
- d1q46a2 appears in the current release, SCOPe 2.08
View in 3D
