Lineage for d1q46a1 (1q46 A:89-175)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2002281Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) (S)
  5. 2002282Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)
  6. 2002283Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)
  7. 2002284Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116746] (1 PDB entry)
  8. 2002285Domain d1q46a1: 1q46 A:89-175 [111594]
    Other proteins in same PDB: d1q46a2

Details for d1q46a1

PDB Entry: 1q46 (more details), 2.86 Å

PDB Description: crystal structure of the eIF2 alpha subunit from saccharomyces cerevisia
PDB Compounds: (A:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d1q46a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q46a1 a.60.14.1 (A:89-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi
idetvwegieppskdvldelknyiskr

SCOPe Domain Coordinates for d1q46a1:

Click to download the PDB-style file with coordinates for d1q46a1.
(The format of our PDB-style files is described here.)

Timeline for d1q46a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q46a2