![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.60: SAM domain-like [47768] (14 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.14: eIF2alpha middle domain-like [116742] (1 family) ![]() |
![]() | Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein) |
![]() | Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116746] (1 PDB entry) |
![]() | Domain d1q46a1: 1q46 A:89-175 [111594] Other proteins in same PDB: d1q46a2 |
PDB Entry: 1q46 (more details), 2.86 Å
SCOP Domain Sequences for d1q46a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q46a1 a.60.14.1 (A:89-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)} vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi idetvwegieppskdvldelknyiskr
Timeline for d1q46a1: