Lineage for d1ni5a4 (1ni5 A:227-314)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613871Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
    beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432
  4. 2613872Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family) (S)
  5. 2613873Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)
  6. 2613886Protein tRNA-Ile-lysidine synthetase, TilS, substrate-binding domain [82831] (1 species)
    formerly putative cell cycle protein MesJ
  7. 2613887Species Escherichia coli [TaxId:562] [82832] (1 PDB entry)
  8. 2613888Domain d1ni5a4: 1ni5 A:227-314 [111593]
    Other proteins in same PDB: d1ni5a1, d1ni5a3, d1ni5a5

Details for d1ni5a4

PDB Entry: 1ni5 (more details), 2.65 Å

PDB Description: structure of the mesj pp-atpase from escherichia coli
PDB Compounds: (A:) Putative cell cycle protein mesJ

SCOPe Domain Sequences for d1ni5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni5a4 d.229.1.1 (A:227-314) tRNA-Ile-lysidine synthetase, TilS, substrate-binding domain {Escherichia coli [TaxId: 562]}
laddlahcqspqgtlqivpmlamsdarraaiirrwlagqnapmpsrdalvriwqevalar
edaspclrlgafeirryqsqlwwiksvt

SCOPe Domain Coordinates for d1ni5a4:

Click to download the PDB-style file with coordinates for d1ni5a4.
(The format of our PDB-style files is described here.)

Timeline for d1ni5a4: