Lineage for d1ni5a3 (1ni5 A:315-432)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680929Fold b.153: PheT/TilS domain [56036] (1 superfamily)
    core: 3 layers; contains beta-sandwich of unusual topology
  4. 680930Superfamily b.153.1: PheT/TilS domain [56037] (2 families) (S)
    contains putative tRNA-binding structural motif
  5. 680943Family b.153.1.2: tRNA-Ile-lysidine synthetase, TilS, C-terminal domain [116720] (1 protein)
    PfamB 001050
  6. 680944Protein tRNA-Ile-lysidine synthetase, TilS, C-terminal domain [116721] (1 species)
    formerly putative cell cycle protein MesJ
  7. 680945Species Escherichia coli [TaxId:562] [116722] (1 PDB entry)
  8. 680946Domain d1ni5a3: 1ni5 A:315-432 [111592]
    Other proteins in same PDB: d1ni5a1, d1ni5a4
    complexed with mse

Details for d1ni5a3

PDB Entry: 1ni5 (more details), 2.65 Å

PDB Description: structure of the mesj pp-atpase from escherichia coli
PDB Compounds: (A:) Putative cell cycle protein mesJ

SCOP Domain Sequences for d1ni5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni5a3 b.153.1.2 (A:315-432) tRNA-Ile-lysidine synthetase, TilS, C-terminal domain {Escherichia coli [TaxId: 562]}
gqsenivpwqtwlqplelpaglgsvqlnaggdirppradeavsvrfkapgllhivgrngg
rklkkiwqelgvppwlrdttpllfygetliaaagvfvtqegvaegengvsfvwqktls

SCOP Domain Coordinates for d1ni5a3:

Click to download the PDB-style file with coordinates for d1ni5a3.
(The format of our PDB-style files is described here.)

Timeline for d1ni5a3: