Lineage for d1lnqc4 (1lnq C:245-336)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617258Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
  4. 617259Superfamily d.286.1: TrkA C-terminal domain-like [116726] (1 family) (S)
  5. 617260Family d.286.1.1: TrkA C-terminal domain-like [116727] (1 protein)
    Pfam 02080
  6. 617261Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)
  7. 617262Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (1 PDB entry)
  8. 617265Domain d1lnqc4: 1lnq C:245-336 [111581]
    Other proteins in same PDB: d1lnqa2, d1lnqa3, d1lnqb2, d1lnqb3, d1lnqc2, d1lnqc3, d1lnqd2, d1lnqd3, d1lnqe2, d1lnqe3, d1lnqf2, d1lnqf3, d1lnqg2, d1lnqg3, d1lnqh2, d1lnqh3

Details for d1lnqc4

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

SCOP Domain Sequences for d1lnqc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqc4 d.286.1.1 (C:245-336) Potassium channel-related protein MthK, C-terminal domain {Archaeon Methanothermobacter thermautotrophicus}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOP Domain Coordinates for d1lnqc4:

Click to download the PDB-style file with coordinates for d1lnqc4.
(The format of our PDB-style files is described here.)

Timeline for d1lnqc4: