Lineage for d1lnqa4 (1lnq A:245-336)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741399Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 741400Superfamily d.286.1: TrkA C-terminal domain-like [116726] (1 family) (S)
  5. 741401Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 741408Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)
  7. 741409Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (2 PDB entries)
  8. 741418Domain d1lnqa4: 1lnq A:245-336 [111577]
    Other proteins in same PDB: d1lnqa2, d1lnqa3, d1lnqb2, d1lnqb3, d1lnqc2, d1lnqc3, d1lnqd2, d1lnqd3, d1lnqe2, d1lnqe3, d1lnqf2, d1lnqf3, d1lnqg2, d1lnqg3, d1lnqh2, d1lnqh3

Details for d1lnqa4

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a
PDB Compounds: (A:) potassium channel related protein

SCOP Domain Sequences for d1lnqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqa4 d.286.1.1 (A:245-336) Potassium channel-related protein MthK, C-terminal domain {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOP Domain Coordinates for d1lnqa4:

Click to download the PDB-style file with coordinates for d1lnqa4.
(The format of our PDB-style files is described here.)

Timeline for d1lnqa4: