Lineage for d1kl9a2 (1kl9 A:3-88)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399347Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species)
  7. 2399350Species Human (Homo sapiens) [TaxId:9606] [74951] (2 PDB entries)
    Uniprot P05198
  8. 2399351Domain d1kl9a2: 1kl9 A:3-88 [111575]
    Other proteins in same PDB: d1kl9a1
    complexed with zn

Details for d1kl9a2

PDB Entry: 1kl9 (more details), 1.9 Å

PDB Description: crystal structure of the n-terminal segment of human eukaryotic initiation factor 2alpha
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 subunit 1

SCOPe Domain Sequences for d1kl9a2:

Sequence, based on SEQRES records: (download)

>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lscrfyqhkfpevedvvmvnvrsiaemgayvslleynniegmillselsrrrirsinkli
rigrnecvvvirvdkekgyidlskrr

Sequence, based on observed residues (ATOM records): (download)

>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lscrfyqhkfpevedvvmvnvrsiaemgayvslleynniegmillselrigrnecvvvir
vdkekgyidlskrr

SCOPe Domain Coordinates for d1kl9a2:

Click to download the PDB-style file with coordinates for d1kl9a2.
(The format of our PDB-style files is described here.)

Timeline for d1kl9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kl9a1