SCOP 1.73: Domain d1kl9a1: 1kl9 A:89-182

Lineage for d1kl9a1 (1kl9 A:89-182)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.14: eIF2alpha middle domain-like [116742] (1 family)

5. Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)

6. Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116745] (2 PDB entries)

8. Domain d1kl9a1: 1kl9 A:89-182 [111574]
   Other proteins in same PDB: d1kl9a2
   complexed with mse, zn

Details for d1kl9a1

PDB Entry: 1kl9, 1.9 Å

PDB Description: crystal structure of the n-terminal segment of human eukaryotic initiation factor 2alpha

PDB Compounds: (A:) Eukaryotic translation initiation factor 2 subunit 1

SCOP Domain Sequences for d1kl9a1:

Sequence; same for both SEQRES and ATOM records:

>d1kl9a1 a.60.14.1 (A:89-182) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
vspeeaikcedkftksktvysilrhvaevleytkdeqleslfqrtawvfddkykrpgyga
ydafkhavsdpsildsldlnederevlinninrr

Timeline for d1kl9a1:

• d1kl9a1 first appeared in SCOP 1.71
  
• d1kl9a1 appears in SCOP 1.75
  
• d1kl9a1 appears in the current release, SCOPe 2.08