Lineage for d1kl9a1 (1kl9 A:89-182)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716745Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) (S)
  5. 2716746Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)
  6. 2716747Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)
  7. 2716750Species Human (Homo sapiens) [TaxId:9606] [116745] (2 PDB entries)
    Uniprot P05198
  8. 2716751Domain d1kl9a1: 1kl9 A:89-182 [111574]
    Other proteins in same PDB: d1kl9a2
    complexed with zn

Details for d1kl9a1

PDB Entry: 1kl9 (more details), 1.9 Å

PDB Description: crystal structure of the n-terminal segment of human eukaryotic initiation factor 2alpha
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 subunit 1

SCOPe Domain Sequences for d1kl9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kl9a1 a.60.14.1 (A:89-182) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
vspeeaikcedkftksktvysilrhvaevleytkdeqleslfqrtawvfddkykrpgyga
ydafkhavsdpsildsldlnederevlinninrr

SCOPe Domain Coordinates for d1kl9a1:

Click to download the PDB-style file with coordinates for d1kl9a1.
(The format of our PDB-style files is described here.)

Timeline for d1kl9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kl9a2