![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.287: DNA methylase specificity domain [116733] (1 superfamily) comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin |
![]() | Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) ![]() |
![]() | Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein) |
![]() | Protein DNA methylase TaqI, C-terminal domain [116736] (1 species) |
![]() | Species Thermus aquaticus [TaxId:271] [116737] (6 PDB entries) |
![]() | Domain d1g38d2: 1g38 D:244-413 [111570] Other proteins in same PDB: d1g38a1, d1g38d1 complexed with ch3, nea |
PDB Entry: 1g38 (more details), 2 Å
SCOP Domain Sequences for d1g38d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g38d2 d.287.1.1 (D:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]} rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht
Timeline for d1g38d2: