Lineage for d1g38d1 (1g38 D:21-243)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865230Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (2 proteins)
  6. 1865231Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 1865232Species Thermus aquaticus [TaxId:271] [53370] (11 PDB entries)
  8. 1865240Domain d1g38d1: 1g38 D:21-243 [111569]
    Other proteins in same PDB: d1g38a2, d1g38d2
    protein/DNA complex; complexed with nea

Details for d1g38d1

PDB Entry: 1g38 (more details), 2 Å

PDB Description: adenine-specific methyltransferase m. taq i/dna complex
PDB Compounds: (D:) modification methylase taqi

SCOPe Domain Sequences for d1g38d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g38d1 c.66.1.27 (D:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

SCOPe Domain Coordinates for d1g38d1:

Click to download the PDB-style file with coordinates for d1g38d1.
(The format of our PDB-style files is described here.)

Timeline for d1g38d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g38d2