Lineage for d1g38a2 (1g38 A:244-413)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009817Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 3009818Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 3009819Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)
  6. 3009820Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)
  7. 3009821Species Thermus aquaticus [TaxId:271] [116737] (11 PDB entries)
  8. 3009828Domain d1g38a2: 1g38 A:244-413 [111568]
    Other proteins in same PDB: d1g38a1, d1g38d1
    protein/DNA complex; complexed with nea

Details for d1g38a2

PDB Entry: 1g38 (more details), 2 Å

PDB Description: adenine-specific methyltransferase m. taq i/dna complex
PDB Compounds: (A:) modification methylase taqi

SCOPe Domain Sequences for d1g38a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g38a2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

SCOPe Domain Coordinates for d1g38a2:

Click to download the PDB-style file with coordinates for d1g38a2.
(The format of our PDB-style files is described here.)

Timeline for d1g38a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g38a1