SCOPe 2.07: Domain d1aqjb2: 1aqj B:244-413

Lineage for d1aqjb2 (1aqj B:244-413)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)

6. Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)

7. Species Thermus aquaticus [TaxId:271] [116737] (11 PDB entries)

8. Domain d1aqjb2: 1aqj B:244-413 [111566]
   Other proteins in same PDB: d1aqja1, d1aqjb1
   complexed with sfg

Details for d1aqjb2

PDB Entry: 1aqj, 2.6 Å

PDB Description: structure of adenine-n6-dna-methyltransferase taqi

PDB Compounds: (B:) adenine-n6-DNA-methyltransferase taqi

SCOPe Domain Sequences for d1aqjb2:

Sequence; same for both SEQRES and ATOM records:

>d1aqjb2 d.287.1.1 (B:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

Timeline for d1aqjb2:

• d1aqjb2 first appeared in SCOP 1.71
  
• d1aqjb2 appears in SCOPe 2.06
  
• d1aqjb2 appears in the current release, SCOPe 2.08