Lineage for d1aqja2 (1aqj A:244-413)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2241945Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 2241946Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 2241947Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)
  6. 2241948Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)
  7. 2241949Species Thermus aquaticus [TaxId:271] [116737] (11 PDB entries)
  8. 2241964Domain d1aqja2: 1aqj A:244-413 [111564]
    Other proteins in same PDB: d1aqja1, d1aqjb1
    complexed with sfg

Details for d1aqja2

PDB Entry: 1aqj (more details), 2.6 Å

PDB Description: structure of adenine-n6-dna-methyltransferase taqi
PDB Compounds: (A:) adenine-n6-DNA-methyltransferase taqi

SCOPe Domain Sequences for d1aqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqja2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

SCOPe Domain Coordinates for d1aqja2:

Click to download the PDB-style file with coordinates for d1aqja2.
(The format of our PDB-style files is described here.)

Timeline for d1aqja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqja1