Lineage for d1aqja1 (1aqj A:21-243)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705008Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein)
  6. 705009Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 705010Species Thermus aquaticus [TaxId:271] [53370] (6 PDB entries)
  8. 705021Domain d1aqja1: 1aqj A:21-243 [111563]
    Other proteins in same PDB: d1aqja2, d1aqjb2

Details for d1aqja1

PDB Entry: 1aqj (more details), 2.6 Å

PDB Description: structure of adenine-n6-dna-methyltransferase taqi
PDB Compounds: (A:) adenine-n6-DNA-methyltransferase taqi

SCOP Domain Sequences for d1aqja1:

Sequence, based on SEQRES records: (download)

>d1aqja1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

Sequence, based on observed residues (ATOM records): (download)

>d1aqja1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivavkdlykkafstwkgkynlygaflekavr
llkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvsavvirfqksg
kglslwdtqesesgftpilwaeyphwegeii

SCOP Domain Coordinates for d1aqja1:

Click to download the PDB-style file with coordinates for d1aqja1.
(The format of our PDB-style files is described here.)

Timeline for d1aqja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqja2