SCOP 1.73: Domain d1aqib2: 1aqi B:244-413

Lineage for d1aqib2 (1aqi B:244-413)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein)

6. Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)

7. Species Thermus aquaticus [TaxId:271] [116737] (6 PDB entries)

8. Domain d1aqib2: 1aqi B:244-413 [111562]
   Other proteins in same PDB: d1aqia1, d1aqib1
   complexed with sah

Details for d1aqib2

PDB Entry: 1aqi, 2.6 Å

PDB Description: structure of adenine-n6-dna-methyltransferase taqi

PDB Compounds: (B:) adenine-n6-DNA-methyltransferase taqi

SCOP Domain Sequences for d1aqib2:

Sequence; same for both SEQRES and ATOM records:

>d1aqib2 d.287.1.1 (B:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

Timeline for d1aqib2:

• d1aqib2 first appeared in SCOP 1.71
  
• d1aqib2 appears in SCOP 1.75
  
• d1aqib2 appears in the current release, SCOPe 2.08