Lineage for d1aqia1 (1aqi A:21-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501487Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (2 proteins)
  6. 2501488Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 2501489Species Thermus aquaticus [TaxId:271] [53370] (11 PDB entries)
  8. 2501504Domain d1aqia1: 1aqi A:21-243 [111559]
    Other proteins in same PDB: d1aqia2, d1aqib2
    complexed with sah

Details for d1aqia1

PDB Entry: 1aqi (more details), 2.6 Å

PDB Description: structure of adenine-n6-dna-methyltransferase taqi
PDB Compounds: (A:) adenine-n6-DNA-methyltransferase taqi

SCOPe Domain Sequences for d1aqia1:

Sequence, based on SEQRES records: (download)

>d1aqia1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

Sequence, based on observed residues (ATOM records): (download)

>d1aqia1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtgyrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivkavkdlykkafstwkgkynlygaflekav
rllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvsavvirfqks
gkglslwdtqesesgftpilwaeyphwegeii

SCOPe Domain Coordinates for d1aqia1:

Click to download the PDB-style file with coordinates for d1aqia1.
(The format of our PDB-style files is described here.)

Timeline for d1aqia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqia2