Lineage for d1xi3b_ (1xi3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079968Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) (S)
    automatically mapped to Pfam PF02581
  5. 2079969Family c.1.3.1: Thiamin phosphate synthase [51392] (2 protein domains)
  6. 2079970Protein Thiamin phosphate synthase [51393] (2 species)
  7. 2079989Species Pyrococcus furiosus [TaxId:2261] [110344] (1 PDB entry)
    Uniprot Q8U192
  8. 2079991Domain d1xi3b_: 1xi3 B: [109602]
    Structural genomics target
    complexed with ni, so4, unx

Details for d1xi3b_

PDB Entry: 1xi3 (more details), 1.7 Å

PDB Description: thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu- 1255191-001
PDB Compounds: (B:) Thiamine phosphate pyrophosphorylase

SCOPe Domain Sequences for d1xi3b_:

Sequence, based on SEQRES records: (download)

>d1xi3b_ c.1.3.1 (B:) Thiamin phosphate synthase {Pyrococcus furiosus [TaxId: 2261]}
nlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigktlrqltrey
dalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvysleealeaekkga
dylgagsvfptktkedarvigleglrkivesvkipvvaigginkdnarevlktgvdgiav
isavmgaedvrkateelrkiveevlg

Sequence, based on observed residues (ATOM records): (download)

>d1xi3b_ c.1.3.1 (B:) Thiamin phosphate synthase {Pyrococcus furiosus [TaxId: 2261]}
nlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigktlrqltrey
dalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvysleealeaekkga
dylgagsvfptdarvigleglrkivesvkipvvaigginkdnarevlktgvdgiavisav
mgaedvrkateelrkiveevlg

SCOPe Domain Coordinates for d1xi3b_:

Click to download the PDB-style file with coordinates for d1xi3b_.
(The format of our PDB-style files is described here.)

Timeline for d1xi3b_: