Lineage for d1xi3a_ (1xi3 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473625Superfamily c.1.3: Thiamin phosphate synthase [51391] (1 family) (S)
  5. 473626Family c.1.3.1: Thiamin phosphate synthase [51392] (1 protein)
  6. 473627Protein Thiamin phosphate synthase [51393] (2 species)
  7. 473628Species Archaeon (Pyrococcus furiosus) [TaxId:2261] [110344] (1 PDB entry)
  8. 473629Domain d1xi3a_: 1xi3 A: [109601]

Details for d1xi3a_

PDB Entry: 1xi3 (more details), 1.7 Å

PDB Description: thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu- 1255191-001

SCOP Domain Sequences for d1xi3a_:

Sequence, based on SEQRES records: (download)

>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus)}
nlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigktlrqltrey
dalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvysleealeaekkga
dylgagsvfptktkedarvigleglrkivesvkipvvaigginkdnarevlktgvdgiav
isavmgaedvrkateelrkiveevlg

Sequence, based on observed residues (ATOM records): (download)

>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus)}
nlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigktlrqltrey
dalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvysleealeaekkga
dylgagsvfptdarvigleglrkivesvkipvvaigginkdnarevlktgvdgiavisav
mgaedvrkateelrkiveevlg

SCOP Domain Coordinates for d1xi3a_:

Click to download the PDB-style file with coordinates for d1xi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1xi3a_:

Domains from other chains:
(mouse over for more information)
d1xi3b_