Lineage for d1xhva_ (1xhv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121407Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
    automatically mapped to Pfam PF09226
  6. 2121408Protein Restriction endonuclease HincII [69526] (1 species)
  7. 2121409Species Haemophilus influenzae [TaxId:727] [69527] (19 PDB entries)
    Uniprot P17743 ! Uniprot P44413
  8. 2121423Domain d1xhva_: 1xhv A: [109597]
    protein/DNA complex; complexed with mn

Details for d1xhva_

PDB Entry: 1xhv (more details), 2.5 Å

PDB Description: hincii bound to cleaved cognate dna gtcgac and mn2+
PDB Compounds: (A:) Type II restriction enzyme HincII

SCOPe Domain Sequences for d1xhva_:

Sequence, based on SEQRES records: (download)

>d1xhva_ c.52.1.19 (A:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyil

Sequence, based on observed residues (ATOM records): (download)

>d1xhva_ c.52.1.19 (A:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrptlsghaagepfeklvykflkenlsdltfkqyeylndlf
mknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfye
lldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvs
tsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqrais
midkfvkpfkkyil

SCOPe Domain Coordinates for d1xhva_:

Click to download the PDB-style file with coordinates for d1xhva_.
(The format of our PDB-style files is described here.)

Timeline for d1xhva_: