Lineage for d1xhud_ (1xhu D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170832Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
  6. 1170833Protein Restriction endonuclease HincII [69526] (1 species)
  7. 1170834Species Haemophilus influenzae [TaxId:727] [69527] (18 PDB entries)
    Uniprot P17743 ! Uniprot P44413
  8. 1170881Domain d1xhud_: 1xhu D: [109596]
    protein/DNA complex

Details for d1xhud_

PDB Entry: 1xhu (more details), 2.95 Å

PDB Description: hincii bound to cleaved, cognate dna containing gtcgac
PDB Compounds: (D:) Type II restriction enzyme HincII

SCOPe Domain Sequences for d1xhud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhud_ c.52.1.19 (D:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyi

SCOPe Domain Coordinates for d1xhud_:

Click to download the PDB-style file with coordinates for d1xhud_.
(The format of our PDB-style files is described here.)

Timeline for d1xhud_: