Lineage for d1xhud_ (1xhu D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487731Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 487732Superfamily c.52.1: Restriction endonuclease-like [52980] (23 families) (S)
  5. 487936Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
  6. 487937Protein Restriction endonuclease HincII [69526] (1 species)
  7. 487938Species Haemophilus influenzae [TaxId:727] [69527] (4 PDB entries)
  8. 487954Domain d1xhud_: 1xhu D: [109596]

Details for d1xhud_

PDB Entry: 1xhu (more details), 2.95 Å

PDB Description: hincii bound to cleaved, cognate dna containing gtcgac

SCOP Domain Sequences for d1xhud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhud_ c.52.1.19 (D:) Restriction endonuclease HincII {Haemophilus influenzae}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyi

SCOP Domain Coordinates for d1xhud_:

Click to download the PDB-style file with coordinates for d1xhud_.
(The format of our PDB-style files is described here.)

Timeline for d1xhud_: