SCOP 1.73: Domain d1xhub_: 1xhu B:

Lineage for d1xhub_ (1xhu B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (31 families)

5. Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)

6. Protein Restriction endonuclease HincII [69526] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [69527] (6 PDB entries)

8. Domain d1xhub_: 1xhu B: [109594]

Details for d1xhub_

PDB Entry: 1xhu, 2.95 Å

PDB Description: hincii bound to cleaved, cognate dna containing gtcgac

PDB Compounds: (B:) Type II restriction enzyme HincII

SCOP Domain Sequences for d1xhub_:

Sequence; same for both SEQRES and ATOM records:

>d1xhub_ c.52.1.19 (B:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyi

Timeline for d1xhub_:

• d1xhub_ first appeared in SCOP 1.69
  
• d1xhub_ appears in SCOP 1.71
  
• d1xhub_ appears in SCOP 1.75
  
• d1xhub_ appears in the current release, SCOPe 2.08