Lineage for d1xhlb_ (1xhl B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450947Protein Hypothetical protein F25D1.5 [110415] (1 species)
  7. 2450948Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110416] (1 PDB entry)
    Uniprot Q19774
  8. 2450950Domain d1xhlb_: 1xhl B: [109592]
    complexed with ndp, tne

Details for d1xhlb_

PDB Entry: 1xhl (more details), 2.4 Å

PDB Description: Crystal Structure of putative Tropinone Reductase-II from Caenorhabditis Elegans with Cofactor and Substrate
PDB Compounds: (B:) Short-chain dehydrogenase/reductase family member (5L265), putative Tropinone Reductase-II

SCOPe Domain Sequences for d1xhlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhlb_ c.2.1.2 (B:) Hypothetical protein F25D1.5 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
rfsgksviitgssngigrsaavifakegaqvtitgrnedrleetkqqilkagvpaekina
vvadvteasgqddiinttlakfgkidilvnnaganladgtantdqpvelyqktfklnfqa
viemtqktkehliktkgeivnvssivagpqahsgypyyacakaaldqytrctaidliqhg
vrvnsvspgavatgfmgamglpetasdklysfigsrkecipvghcgkpeeianiivflad
rnlssyiigqsivadggstlvmgmqthdlmsvls

SCOPe Domain Coordinates for d1xhlb_:

Click to download the PDB-style file with coordinates for d1xhlb_.
(The format of our PDB-style files is described here.)

Timeline for d1xhlb_: