SCOPe 2.06: Domain d1xhlb_: 1xhl B:

Lineage for d1xhlb_ (1xhl B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Hypothetical protein F25D1.5 [110415] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110416] (1 PDB entry)
   Uniprot Q19774

8. Domain d1xhlb_: 1xhl B: [109592]
   complexed with ndp, tne

Details for d1xhlb_

PDB Entry: 1xhl, 2.4 Å

PDB Description: Crystal Structure of putative Tropinone Reductase-II from Caenorhabditis Elegans with Cofactor and Substrate

PDB Compounds: (B:) Short-chain dehydrogenase/reductase family member (5L265), putative Tropinone Reductase-II

SCOPe Domain Sequences for d1xhlb_:

Sequence; same for both SEQRES and ATOM records:

>d1xhlb_ c.2.1.2 (B:) Hypothetical protein F25D1.5 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
rfsgksviitgssngigrsaavifakegaqvtitgrnedrleetkqqilkagvpaekina
vvadvteasgqddiinttlakfgkidilvnnaganladgtantdqpvelyqktfklnfqa
viemtqktkehliktkgeivnvssivagpqahsgypyyacakaaldqytrctaidliqhg
vrvnsvspgavatgfmgamglpetasdklysfigsrkecipvghcgkpeeianiivflad
rnlssyiigqsivadggstlvmgmqthdlmsvls

Timeline for d1xhlb_:

• d1xhlb_ first appeared in SCOP 1.69
  
• d1xhlb_ appears in SCOPe 2.05
  
• d1xhlb_ appears in SCOPe 2.07
  
• d1xhlb_ appears in the current release, SCOPe 2.08