![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.5: AHSA1 domain [111168] (12 proteins) Pfam PF05146 |
![]() | Protein Hypothetical protein NE0264 [111169] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [111170] (1 PDB entry) Uniprot Q82XK1 |
![]() | Domain d1xfsb_: 1xfs B: [109590] Structural genomics target |
PDB Entry: 1xfs (more details), 1.7 Å
SCOPe Domain Sequences for d1xfsb_:
Sequence, based on SEQRES records: (download)
>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtavielqpt ssgtrytacamhntpgqrklheemgfhegwgttitqleellkqek
>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpivmtavielqptssgtrytaca mhntpgqrklheemgfhgwgttitqleellkqek
Timeline for d1xfsb_: