SCOPe 2.01: Domain d1xfsb_: 1xfs B:

Lineage for d1xfsb_ (1xfs B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
   Pfam PF05146

6. Protein Hypothetical protein NE0264 [111169] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [111170] (1 PDB entry)
   Uniprot Q82XK1

8. Domain d1xfsb_: 1xfs B: [109590]
   Structural genomics target

Details for d1xfsb_

PDB Entry: 1xfs, 1.7 Å

PDB Description: x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5.

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1xfsb_:

Sequence, based on SEQRES records:

>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}
tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm
qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtavielqpt
ssgtrytacamhntpgqrklheemgfhegwgttitqleellkqek

Sequence, based on observed residues (ATOM records):

>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}
tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm
qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpivmtavielqptssgtrytaca
mhntpgqrklheemgfhgwgttitqleellkqek

Timeline for d1xfsb_:

• d1xfsb_ first appeared in SCOP 1.69
  
• d1xfsb_ appears in SCOP 1.75
  
• d1xfsb_ appears in SCOPe 2.02
  
• d1xfsb_ appears in the current release, SCOPe 2.08