Lineage for d1xfsb_ (1xfs B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872866Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
    Pfam PF05146
  6. 872897Protein Hypothetical protein NE0264 [111169] (1 species)
  7. 872898Species Nitrosomonas europaea [TaxId:915] [111170] (1 PDB entry)
    Uniprot Q82XK1
  8. 872900Domain d1xfsb_: 1xfs B: [109590]
    Structural genomics target

Details for d1xfsb_

PDB Entry: 1xfs (more details), 1.7 Å

PDB Description: x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5.
PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d1xfsb_:

Sequence, based on SEQRES records: (download)

>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}
tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm
qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtavielqpt
ssgtrytacamhntpgqrklheemgfhegwgttitqleellkqek

Sequence, based on observed residues (ATOM records): (download)

>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}
tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm
qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpivmtavielqptssgtrytaca
mhntpgqrklheemgfhgwgttitqleellkqek

SCOP Domain Coordinates for d1xfsb_:

Click to download the PDB-style file with coordinates for d1xfsb_.
(The format of our PDB-style files is described here.)

Timeline for d1xfsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xfsa_