Lineage for d1xfsb_ (1xfs B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 511069Superfamily d.129.3: Bet v1-like [55961] (5 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 511144Family d.129.3.5: Aha1 domain (Pfam 05146) [111168] (1 protein)
  6. 511145Protein Hypothetical protein NE0264 [111169] (1 species)
  7. 511146Species Nitrosomonas europaea [TaxId:915] [111170] (1 PDB entry)
  8. 511148Domain d1xfsb_: 1xfs B: [109590]
    Structural genomics target

Details for d1xfsb_

PDB Entry: 1xfs (more details), 1.7 Å

PDB Description: x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5.

SCOP Domain Sequences for d1xfsb_:

Sequence, based on SEQRES records: (download)

>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea}
tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm
qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtavielqpt
ssgtrytacamhntpgqrklheemgfhegwgttitqleellkqek

Sequence, based on observed residues (ATOM records): (download)

>d1xfsb_ d.129.3.5 (B:) Hypothetical protein NE0264 {Nitrosomonas europaea}
tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm
qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpivmtavielqptssgtrytaca
mhntpgqrklheemgfhgwgttitqleellkqek

SCOP Domain Coordinates for d1xfsb_:

Click to download the PDB-style file with coordinates for d1xfsb_.
(The format of our PDB-style files is described here.)

Timeline for d1xfsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xfsa_