Lineage for d1xfsa_ (1xfs A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926579Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 1926610Protein Hypothetical protein NE0264 [111169] (1 species)
  7. 1926611Species Nitrosomonas europaea [TaxId:915] [111170] (1 PDB entry)
    Uniprot Q82XK1
  8. 1926612Domain d1xfsa_: 1xfs A: [109589]
    Structural genomics target

Details for d1xfsa_

PDB Entry: 1xfs (more details), 1.7 Å

PDB Description: x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5.
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1xfsa_:

Sequence, based on SEQRES records: (download)

>d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}
idaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvmqd
pegnkfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtavielqptss
gtrytacamhntpgqrklheemgfhegwgttitqleellkqekay

Sequence, based on observed residues (ATOM records): (download)

>d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}
idaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvmqd
pegnkfpnsgcflevtdekrliwtsalvknyrpavpvmtavielqptssgtrytacamhn
tpgqrklheemgfhegwgttitqleellkqekay

SCOPe Domain Coordinates for d1xfsa_:

Click to download the PDB-style file with coordinates for d1xfsa_.
(The format of our PDB-style files is described here.)

Timeline for d1xfsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xfsb_