Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (22 PDB entries) SQ NA # camelid antibody |
Domain d1xfpa_: 1xfp A: [109587] Other proteins in same PDB: d1xfpl_ complexed with fmt; mutant |
PDB Entry: 1xfp (more details), 1.5 Å
SCOP Domain Sequences for d1xfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfpa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainsgggstyya dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd swgqgtqvtvs
Timeline for d1xfpa_: