SCOP 1.75: Domain d1xfpa_: 1xfp A:

Lineage for d1xfpa_ (1xfp A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (22 PDB entries)
   SQ NA # camelid antibody

8. Domain d1xfpa_: 1xfp A: [109587]
   Other proteins in same PDB: d1xfpl_
   complexed with fmt; mutant

Details for d1xfpa_

PDB Entry: 1xfp, 1.5 Å

PDB Description: Crystal structure of the CDR2 germline reversion mutant of cAb-Lys3 in complex with hen egg white lysozyme

PDB Compounds: (A:) heavy chain antibody

SCOP Domain Sequences for d1xfpa_:

Sequence; same for both SEQRES and ATOM records:

>d1xfpa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainsgggstyya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvs

Timeline for d1xfpa_:

• d1xfpa_ first appeared in SCOP 1.69
  
• d1xfpa_ appears in SCOP 1.73
  
• d1xfpa_ appears in SCOPe 2.01
  
• d1xfpa_ appears in the current release, SCOPe 2.08