SCOPe 2.05: Domain d1xfla_: 1xfl A:

Lineage for d1xfla_ (1xfl A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110603] (1 PDB entry)
   Uniprot P29448 #

8. Domain d1xfla_: 1xfl A: [109586]
   Structural genomics target

Details for d1xfla_

PDB Entry: 1xfl

PDB Description: solution structure of thioredoxin h1 from arabidopsis thaliana

PDB Compounds: (A:) Thioredoxin h1

SCOPe Domain Sequences for d1xfla_:

Sequence; same for both SEQRES and ATOM records:

>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
maseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapffadlakklpnv
lflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstiakhla

Timeline for d1xfla_:

• d1xfla_ first appeared in SCOP 1.69
  
• d1xfla_ appears in SCOPe 2.04
  
• d1xfla_ appears in SCOPe 2.06
  
• d1xfla_ appears in the current release, SCOPe 2.08