Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (16 families) |
Family c.47.1.1: Thioltransferase [52834] (13 proteins) |
Protein Thioredoxin [52835] (12 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110603] (1 PDB entry) |
Domain d1xfla_: 1xfl A: [109586] Structural genomics target |
PDB Entry: 1xfl (more details)
SCOP Domain Sequences for d1xfla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana)} maseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapffadlakklpnv lflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstiakhla
Timeline for d1xfla_: