![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110603] (1 PDB entry) Uniprot P29448 # |
![]() | Domain d1xfla_: 1xfl A: [109586] Structural genomics target |
PDB Entry: 1xfl (more details)
SCOPe Domain Sequences for d1xfla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} maseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapffadlakklpnv lflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstiakhla
Timeline for d1xfla_: