Lineage for d1xfja_ (1xfj A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611731Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets
  4. 2611732Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) (S)
  5. 2611741Family d.194.1.2: YfiH-like [111238] (5 proteins)
    Pfam PF02578; COG1496
  6. 2611742Protein Hypothetical protein CC0490 [111246] (1 species)
  7. 2611743Species Caulobacter crescentus [TaxId:155892] [111247] (1 PDB entry)
    Uniprot Q9AAV3
  8. 2611744Domain d1xfja_: 1xfj A: [109585]
    Structural genomics target
    complexed with act, bme, gol

Details for d1xfja_

PDB Entry: 1xfj (more details), 1.75 Å

PDB Description: crystal structure of protein cc_0490 from caulobacter crescentus, pfam duf152
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1xfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfja_ d.194.1.2 (A:) Hypothetical protein CC0490 {Caulobacter crescentus [TaxId: 155892]}
alptvqspllsslpgvkhafftrqggvskgiydslnvgrgsqdepadveenrariarwfg
ggpedlnvcyqihstiaivadgswgdarpegdavvsktpgvicgamaadcapvllvdpea
rivaaahagwrgaldgvvqsavdrmvelgaspanitgvvgpcigpksyevgleflhrfea
dcpgsgrffkpgasedkrffdlpafvldrlatagverrewvgrdtraeeewffsnrrafl
nndgdygrllsaitle

SCOPe Domain Coordinates for d1xfja_:

Click to download the PDB-style file with coordinates for d1xfja_.
(The format of our PDB-style files is described here.)

Timeline for d1xfja_: