SCOP 1.71: Domain d1xfgb_: 1xfg B:

Lineage for d1xfgb_ (1xfg B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)

7. Species Escherichia coli [TaxId:562] [56238] (3 PDB entries)

8. Domain d1xfgb_: 1xfg B: [109583]
   complexed with act, hga, na

Details for d1xfgb_

PDB Entry: 1xfg, 1.85 Å

PDB Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate

SCOP Domain Sequences for d1xfgb_:

Sequence; same for both SEQRES and ATOM records:

>d1xfgb_ d.153.1.1 (B:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq

Timeline for d1xfgb_:

• d1xfgb_ first appeared in SCOP 1.69
  
• d1xfgb_ appears in SCOP 1.73
  
• d1xfgb_ appears in the current release, SCOPe 2.08